- SPATA6L Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84648
- C9orf68, bA6J24.2
- Unconjugated
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- SPATA6L
- This antibody was developed against Recombinant Protein corresponding to amino acids: FATYQHSTSP GPLDQPLLRE RFHPGSQSTW KNIHERVCSL LTSHRAQLHQ NKEDSTSEVN YIIERPSYPL KKYSLHE
- spermatogenesis associated 6 like
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FATYQHSTSPGPLDQPLLRERFHPGSQSTWKNIHERVCSLLTSHRAQLHQNKEDSTSEVNYIIERPSYPLKKYSLHE
Specifications/Features
Available conjugates: Unconjugated